This form is pretty straightforward, it should be easy to submit with curl.
In this case you're doing a POST, so start out by reading the section on POST in the HTTP scripting guide.
  http://curl.haxx.se/docs/httpscripting.html

Basically you'll be doing something like this:

  curl --data-urlencode "INSERT_YOUR_POST_DATA_HERE" http://consurf.tau.ac.il/cgi-bin/new_consurf.cgi

Your post data will be a string that looks something like this.

"MAX_FILE_SIZE=2000000&PDB_yes_no=no&MSA_yes_no=no&..."

The main job you have is to construct the POST data string from your own results.

Also note that the page you get right after submission is just a placeholder that gets refreshed in the browser until the results are ready. It's not easy to do that with curl, but the URL for the results is all you really need. Or you can use the email feature to get a notification.

If you're planning to submit a large volume of results, make sure you insert a reasonable time delay between submissions so you don't overload the server. You might want to contact the site owner and ask them what they consider a reasonable number of requests per hour.

>-----Original Message-----
>From: curl-users-bounces_at_cool.haxx.se [mailto:curl-users-
>bounces_at_cool.haxx.se] On Behalf Of Shane Neeley
>Sent: Saturday, March 03, 2012 2:41 PM
>To: curl-users_at_cool.haxx.se
>Subject: Re: Biologist new to cURL. Question about interacting with a
>form.
>
>Hi,
>
>These are the HTTP headers generated when I perform my job that I have
>described in the previous email. Do you see how the pasting of FASTA
>sequence (In Red) could be callable on cURL so that I could do it over
>multiple FASTA sequence files?
>
>________________________________________________________________________
>__________________
>
>http://consurf.tau.ac.il/cgi-bin/new_consurf.cgi
>
>POST /cgi-bin/new_consurf.cgi HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/index_full_form_PROT.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.3.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>Content-Type: multipart/form-data; boundary=---------------------------
>168072824752491622650073
>Content-Length: 2301
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="Run_Number"
>
>NONE
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="MAX_FILE_SIZE"
>
>2000000
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="PDB_yes_no"
>
>no
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="MSA_yes_no"
>
>no
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="FASTA_text"
>
>>
>DGVGSSSGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISNGTSGGATNDNTYFGYST
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="MSAprogram"
>
>MAFFT
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="proteins_DB"
>
>UNIREF90
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="MAX_NUM_HOMOL"
>
>150
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="MAX_REDUNDANCY"
>
>95
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="MIN_IDENTITY"
>
>35
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="ITERATIONS"
>
>1
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="E_VALUE"
>
>0.0001
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="Homolog_search_algorithm"
>
>BLAST
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="ALGORITHM"
>
>Bayes
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="SUB_MATRIX"
>
>JTT
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="JOB_TITLE"
>
>
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="user_email"
>
>
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="send_user_mail"
>
>yes
>-----------------------------168072824752491622650073
>Content-Disposition: form-data; name="submitForm"
>
>Submit
>-----------------------------168072824752491622650073--
>
>HTTP/1.1 302 Found
>Date: Sat, 03 Mar 2012 19:31:39 GMT
>Server: Apache/2.2.8 (EL)
>Location: http://consurf.tau.ac.il/results/1330803099/output.php
>Content-Length: 238
>Connection: close
>Content-Type: text/html; charset=iso-8859-1
>----------------------------------------------------------
>http://consurf.tau.ac.il/results/1330803099/output.php
>
>GET /results/1330803099/output.php HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/index_full_form_PROT.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.3.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>
>HTTP/1.1 200 OK
>Date: Sat, 03 Mar 2012 19:31:41 GMT
>Server: Apache/2.2.8 (EL)
>X-Powered-By: PHP/5.1.6
>Content-Length: 4123
>Connection: close
>Content-Type: text/html; charset=UTF-8
>----------------------------------------------------------
>http://www.google-
>analytics.com/__utm.gif?utmwv=5.2.5&utms=4&utmn=1200564064&utmhn=consurf
>.tau.ac.il&utmcs=UTF-8&utmsr=1280x800&utmvp=994x637&utmsc=24-
>bit&utmul=en-
>us&utmje=1&utmfl=10.3%20r183&utmdt=ConSurf%20run%20no.%201330803099%20no
>%20PDB&utmhid=1772989055&utmr=0&utmp=%2Fresults%2F1330803099%2Foutput.ph
>p&utmac=UA-12265767-
>3&utmcc=__utma%3D128144414.851853261.1330802995.1330802995.1330802995.1%
>3B%2B__utmz%3D128144414.1330802995.1.1.utmcsr%3Dgoogle%7Cutmccn%3D(organ
>ic)%7Cutmcmd%3Dorganic%7Cutmctr%3Dconsurf%3B&utmu=D~
>
>GET
>/__utm.gif?utmwv=5.2.5&utms=4&utmn=1200564064&utmhn=consurf.tau.ac.il&ut
>mcs=UTF-8&utmsr=1280x800&utmvp=994x637&utmsc=24-bit&utmul=en-
>us&utmje=1&utmfl=10.3%20r183&utmdt=ConSurf%20run%20no.%201330803099%20no
>%20PDB&utmhid=1772989055&utmr=0&utmp=%2Fresults%2F1330803099%2Foutput.ph
>p&utmac=UA-12265767-
>3&utmcc=__utma%3D128144414.851853261.1330802995.1330802995.1330802995.1%
>3B%2B__utmz%3D128144414.1330802995.1.1.utmcsr%3Dgoogle%7Cutmccn%3D(organ
>ic)%7Cutmcmd%3Dorganic%7Cutmctr%3Dconsurf%3B&utmu=D~ HTTP/1.1
>Host: www.google-analytics.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: image/png,image/*;q=0.8,*/*;q=0.5
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>
>HTTP/1.1 200 OK
>Date: Thu, 01 Mar 2012 23:42:00 GMT
>Content-Length: 35
>X-Content-Type-Options: nosniff
>Pragma: no-cache
>Expires: Wed, 19 Apr 2000 11:43:00 GMT
>Last-Modified: Wed, 21 Jan 2004 19:51:30 GMT
>Content-Type: image/gif
>Cache-Control: private, no-cache, no-cache=Set-Cookie, proxy-revalidate
>Age: 157781
>Server: GFE/2.0
>----------------------------------------------------------
>http://consurf.tau.ac.il/results/1330803099/output.php
>
>GET /results/1330803099/output.php HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.4.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>Cache-Control: max-age=0
>
>HTTP/1.1 200 OK
>Date: Sat, 03 Mar 2012 19:32:11 GMT
>Server: Apache/2.2.8 (EL)
>X-Powered-By: PHP/5.1.6
>Connection: close
>Transfer-Encoding: chunked
>Content-Type: text/html; charset=UTF-8
>----------------------------------------------------------
>http://consurf.tau.ac.il/javascript_functions.js
>
>GET /javascript_functions.js HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: */*
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.4.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>If-Modified-Since: Wed, 25 Jan 2012 10:51:11 GMT
>If-None-Match: "68073-4d74-4b7580aada5c0"
>Cache-Control: max-age=0
>
>HTTP/1.1 304 Not Modified
>Date: Sat, 03 Mar 2012 19:32:12 GMT
>Server: Apache/2.2.8 (EL)
>Connection: close
>Etag: "68073-4d74-4b7580aada5c0"
>----------------------------------------------------------
>http://consurf.tau.ac.il/text_8_7.css
>
>GET /text_8_7.css HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/css,*/*;q=0.1
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.4.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>If-Modified-Since: Wed, 25 Jan 2012 10:51:13 GMT
>If-None-Match: "680d7-f19-4b7580acc2a40"
>Cache-Control: max-age=0
>
>HTTP/1.1 304 Not Modified
>Date: Sat, 03 Mar 2012 19:32:12 GMT
>Server: Apache/2.2.8 (EL)
>Connection: close
>Etag: "680d7-f19-4b7580acc2a40"
>----------------------------------------------------------
>http://www.google-analytics.com/ga.js
>
>GET /ga.js HTTP/1.1
>Host: www.google-analytics.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: */*
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>If-Modified-Since: Thu, 16 Feb 2012 00:48:45 GMT
>Cache-Control: max-age=0
>
>HTTP/1.1 304 Not Modified
>Date: Sat, 03 Mar 2012 17:42:01 GMT
>Expires: Sat, 03 Mar 2012 19:42:01 GMT
>Age: 6611
>Server: GFE/2.0
>----------------------------------------------------------
>http://www.google-
>analytics.com/__utm.gif?utmwv=5.2.5&utms=5&utmn=522809432&utmhn=consurf.
>tau.ac.il&utmcs=UTF-8&utmsr=1280x800&utmvp=994x637&utmsc=24-
>bit&utmul=en-
>us&utmje=1&utmfl=10.3%20r183&utmdt=ConSurf%20run%20no.%201330803099%20no
>%20PDB&utmhid=74642245&utmr=-
>&utmp=%2Fresults%2F1330803099%2Foutput.php&utmac=UA-12265767-
>3&utmcc=__utma%3D128144414.851853261.1330802995.1330802995.1330802995.1%
>3B%2B__utmz%3D128144414.1330802995.1.1.utmcsr%3Dgoogle%7Cutmccn%3D(organ
>ic)%7Cutmcmd%3Dorganic%7Cutmctr%3Dconsurf%3B&utmu=D~
>
>GET
>/__utm.gif?utmwv=5.2.5&utms=5&utmn=522809432&utmhn=consurf.tau.ac.il&utm
>cs=UTF-8&utmsr=1280x800&utmvp=994x637&utmsc=24-bit&utmul=en-
>us&utmje=1&utmfl=10.3%20r183&utmdt=ConSurf%20run%20no.%201330803099%20no
>%20PDB&utmhid=74642245&utmr=-
>&utmp=%2Fresults%2F1330803099%2Foutput.php&utmac=UA-12265767-
>3&utmcc=__utma%3D128144414.851853261.1330802995.1330802995.1330802995.1%
>3B%2B__utmz%3D128144414.1330802995.1.1.utmcsr%3Dgoogle%7Cutmccn%3D(organ
>ic)%7Cutmcmd%3Dorganic%7Cutmctr%3Dconsurf%3B&utmu=D~ HTTP/1.1
>Host: www.google-analytics.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: image/png,image/*;q=0.8,*/*;q=0.5
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>
>HTTP/1.1 200 OK
>Date: Thu, 01 Mar 2012 23:42:00 GMT
>Content-Length: 35
>X-Content-Type-Options: nosniff
>Pragma: no-cache
>Expires: Wed, 19 Apr 2000 11:43:00 GMT
>Last-Modified: Wed, 21 Jan 2004 19:51:30 GMT
>Content-Type: image/gif
>Cache-Control: private, no-cache, no-cache=Set-Cookie, proxy-revalidate
>Age: 157812
>Server: GFE/2.0
>----------------------------------------------------------
>http://consurf.tau.ac.il/consurf_logo.bmp
>
>GET /consurf_logo.bmp HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: image/png,image/*;q=0.8,*/*;q=0.5
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.5.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>If-Modified-Since: Mon, 27 Aug 2007 16:38:05 GMT
>If-None-Match: "604eb-53a96-438b0fb199540"
>Cache-Control: max-age=0
>
>HTTP/1.1 304 Not Modified
>Date: Sat, 03 Mar 2012 19:32:13 GMT
>Server: Apache/2.2.8 (EL)
>Connection: close
>Etag: "604eb-53a96-438b0fb199540"
>----------------------------------------------------------
>http://safebrowsing-
>cache.google.com/safebrowsing/rd/ChNnb29nLW1hbHdhcmUtc2hhdmFyEAAYgasEIIC
>wBCo4aRYBAP_____________________________________________________________
>______wAyIoEVAQD______________________________________wA
>
>GET
>/safebrowsing/rd/ChNnb29nLW1hbHdhcmUtc2hhdmFyEAAYgasEIICwBCo4aRYBAP_____
>______________________________________________________________wAyIoEVAQD
>______________________________________wA HTTP/1.1
>Host: safebrowsing-cache.google.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Cookie:
>PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:
>S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-
>F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1
>TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
>Pragma: no-cache
>Cache-Control: no-cache
>
>HTTP/1.1 200 OK
>Content-Type: application/vnd.google.safebrowsing-chunk
>X-Content-Type-Options: nosniff
>Date: Sat, 03 Mar 2012 19:28:40 GMT
>Server: Chunked Update Server
>Content-Length: 64507
>X-XSS-Protection: 1; mode=block
>X-Frame-Options: SAMEORIGIN
>Cache-Control: public,max-age=172800
>Age: 220
>----------------------------------------------------------
>http://safebrowsing-
>cache.google.com/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchABGIHaBSCA5AU
>qJvhwAQD___________________________________________8BMoMBAW0BAP_________
>______________________9________f________________________________________
>________________________________________________________________________
>______________38
>
>GET
>/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchABGIHaBSCA5AUqJvhwAQD________
>___________________________________8BMoMBAW0BAP_________________________
>______9________f________________________________________________________
>______________________________________________________________________38
>HTTP/1.1
>Host: safebrowsing-cache.google.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Cookie:
>PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:
>S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-
>F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1
>TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
>Pragma: no-cache
>Cache-Control: no-cache
>
>HTTP/1.1 200 OK
>Content-Type: application/vnd.google.safebrowsing-chunk
>X-Content-Type-Options: nosniff
>Date: Sat, 03 Mar 2012 19:28:43 GMT
>Server: Chunked Update Server
>Content-Length: 61064
>X-XSS-Protection: 1; mode=block
>X-Frame-Options: SAMEORIGIN
>Cache-Control: public,max-age=172800
>Age: 217
>----------------------------------------------------------
>http://safebrowsing-
>cache.google.com/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGIGnDCDAqQw
>yLYETAwD______________-______________________________________AA
>
>GET
>/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGIGnDCDAqQwyLYETAwD________
>______-______________________________________AA HTTP/1.1
>Host: safebrowsing-cache.google.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Cookie:
>PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:
>S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-
>F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1
>TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
>Pragma: no-cache
>Cache-Control: no-cache
>
>HTTP/1.1 200 OK
>Content-Type: application/vnd.google.safebrowsing-chunk
>X-Content-Type-Options: nosniff
>Date: Sat, 03 Mar 2012 13:36:53 GMT
>Server: Chunked Update Server
>Content-Length: 94803
>X-XSS-Protection: 1; mode=block
>X-Frame-Options: SAMEORIGIN
>Cache-Control: public,max-age=172800
>Age: 21327
>----------------------------------------------------------
>http://safebrowsing-
>cache.google.com/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGMGpDCCArAw
>yLcEUAwD_____________________________________________________AA
>
>GET
>/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGMGpDCCArAwyLcEUAwD________
>_____________________________________________AA HTTP/1.1
>Host: safebrowsing-cache.google.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Cookie:
>PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:
>S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-
>F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1
>TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
>Pragma: no-cache
>Cache-Control: no-cache
>
>HTTP/1.1 200 OK
>Content-Type: application/vnd.google.safebrowsing-chunk
>X-Content-Type-Options: nosniff
>Date: Sat, 03 Mar 2012 13:36:17 GMT
>Server: Chunked Update Server
>Content-Length: 110783
>X-XSS-Protection: 1; mode=block
>X-Frame-Options: SAMEORIGIN
>Cache-Control: public,max-age=172800
>Age: 21363
>----------------------------------------------------------
>http://safebrowsing-
>cache.google.com/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGIGsDCDArgw
>yLQEWAwD_____________________________________________________AA
>
>GET
>/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGIGsDCDArgwyLQEWAwD________
>_____________________________________________AA HTTP/1.1
>Host: safebrowsing-cache.google.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Cookie:
>PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:
>S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-
>F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1
>TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
>Pragma: no-cache
>Cache-Control: no-cache
>
>HTTP/1.1 200 OK
>Content-Type: application/vnd.google.safebrowsing-chunk
>X-Content-Type-Options: nosniff
>Date: Fri, 02 Mar 2012 18:44:20 GMT
>Server: Chunked Update Server
>Content-Length: 112762
>X-XSS-Protection: 1; mode=block
>X-Frame-Options: SAMEORIGIN
>Cache-Control: public,max-age=172800
>Age: 89281
>----------------------------------------------------------
>http://safebrowsing-
>cache.google.com/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGMGuDCCAsQw
>yLUEXAwD_____________________________________________________AA
>
>GET
>/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGMGuDCCAsQwyLUEXAwD________
>_____________________________________________AA HTTP/1.1
>Host: safebrowsing-cache.google.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Cookie:
>PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:
>S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-
>F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1
>TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
>Pragma: no-cache
>Cache-Control: no-cache
>
>HTTP/1.1 200 OK
>Content-Type: application/vnd.google.safebrowsing-chunk
>X-Content-Type-Options: nosniff
>Date: Sat, 03 Mar 2012 13:20:11 GMT
>Server: Chunked Update Server
>Content-Length: 118923
>X-XSS-Protection: 1; mode=block
>X-Frame-Options: SAMEORIGIN
>Cache-Control: public,max-age=172800
>Age: 22330
>----------------------------------------------------------
>http://safebrowsing-
>cache.google.com/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGIGxDCCAtgw
>qUaEYAwD________________________________________________________________
>_____________________________________ADIJgRgDAP____8A
>
>GET
>/safebrowsing/rd/ChFnb29nLXBoaXNoLXNoYXZhchAAGIGxDCCAtgwqUaEYAwD________
>________________________________________________________________________
>_____________________ADIJgRgDAP____8A HTTP/1.1
>Host: safebrowsing-cache.google.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Cookie:
>PREF=ID=ea5a9a1b579b2f90:U=6b6d71e20c67d066:TM=1330802864:LM=1330802866:
>S=8rg_a0YASysxY_vs; NID=57=HnC0Mttu-MpLiEjPqxXoomslWMffUHMCvMU1qW-
>F44MmgFtfjIFarMMmDv3HvAmgXSYE748BGydeZVMhw6ZlV75D4nuJTnT48zOn7sJt2vSDI_1
>TwLgD0aNng-Us_jWb; GuidedHelpResume=1663256:startNotSignedIn
>Pragma: no-cache
>Cache-Control: no-cache
>
>HTTP/1.1 200 OK
>Content-Type: application/vnd.google.safebrowsing-chunk
>X-Content-Type-Options: nosniff
>Date: Sat, 03 Mar 2012 19:28:40 GMT
>Server: Chunked Update Server
>Content-Length: 14627
>X-XSS-Protection: 1; mode=block
>X-Frame-Options: SAMEORIGIN
>Cache-Control: public,max-age=172800
>Age: 222
>----------------------------------------------------------
>http://consurf.tau.ac.il/results/1330803099/output.php
>
>GET /results/1330803099/output.php HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.5.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>Cache-Control: max-age=0
>
>HTTP/1.1 200 OK
>Date: Sat, 03 Mar 2012 19:32:43 GMT
>Server: Apache/2.2.8 (EL)
>X-Powered-By: PHP/5.1.6
>Content-Length: 4554
>Connection: close
>Content-Type: text/html; charset=UTF-8
>----------------------------------------------------------
>http://consurf.tau.ac.il/javascript_functions.js
>
>GET /javascript_functions.js HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: */*
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.5.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>If-Modified-Since: Wed, 25 Jan 2012 10:51:11 GMT
>If-None-Match: "68073-4d74-4b7580aada5c0"
>Cache-Control: max-age=0
>
>HTTP/1.1 304 Not Modified
>Date: Sat, 03 Mar 2012 19:32:44 GMT
>Server: Apache/2.2.8 (EL)
>Connection: close
>Etag: "68073-4d74-4b7580aada5c0"
>----------------------------------------------------------
>http://consurf.tau.ac.il/text_8_7.css
>
>GET /text_8_7.css HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/css,*/*;q=0.1
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.5.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>If-Modified-Since: Wed, 25 Jan 2012 10:51:13 GMT
>If-None-Match: "680d7-f19-4b7580acc2a40"
>Cache-Control: max-age=0
>
>HTTP/1.1 304 Not Modified
>Date: Sat, 03 Mar 2012 19:32:44 GMT
>Server: Apache/2.2.8 (EL)
>Connection: close
>Etag: "680d7-f19-4b7580acc2a40"
>----------------------------------------------------------
>http://www.google-analytics.com/ga.js
>
>GET /ga.js HTTP/1.1
>Host: www.google-analytics.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: */*
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>If-Modified-Since: Thu, 16 Feb 2012 00:48:45 GMT
>Cache-Control: max-age=0
>
>HTTP/1.1 304 Not Modified
>Date: Sat, 03 Mar 2012 17:42:01 GMT
>Expires: Sat, 03 Mar 2012 19:42:01 GMT
>Age: 6643
>Server: GFE/2.0
>----------------------------------------------------------
>http://www.google-
>analytics.com/__utm.gif?utmwv=5.2.5&utms=6&utmn=147250340&utmhn=consurf.
>tau.ac.il&utmcs=UTF-8&utmsr=1280x800&utmvp=994x637&utmsc=24-
>bit&utmul=en-
>us&utmje=1&utmfl=10.3%20r183&utmdt=ConSurf%20run%20no.%201330803099%20no
>%20PDB&utmhid=1072563392&utmr=-
>&utmp=%2Fresults%2F1330803099%2Foutput.php&utmac=UA-12265767-
>3&utmcc=__utma%3D128144414.851853261.1330802995.1330802995.1330802995.1%
>3B%2B__utmz%3D128144414.1330802995.1.1.utmcsr%3Dgoogle%7Cutmccn%3D(organ
>ic)%7Cutmcmd%3Dorganic%7Cutmctr%3Dconsurf%3B&utmu=D~
>
>GET
>/__utm.gif?utmwv=5.2.5&utms=6&utmn=147250340&utmhn=consurf.tau.ac.il&utm
>cs=UTF-8&utmsr=1280x800&utmvp=994x637&utmsc=24-bit&utmul=en-
>us&utmje=1&utmfl=10.3%20r183&utmdt=ConSurf%20run%20no.%201330803099%20no
>%20PDB&utmhid=1072563392&utmr=-
>&utmp=%2Fresults%2F1330803099%2Foutput.php&utmac=UA-12265767-
>3&utmcc=__utma%3D128144414.851853261.1330802995.1330802995.1330802995.1%
>3B%2B__utmz%3D128144414.1330802995.1.1.utmcsr%3Dgoogle%7Cutmccn%3D(organ
>ic)%7Cutmcmd%3Dorganic%7Cutmctr%3Dconsurf%3B&utmu=D~ HTTP/1.1
>Host: www.google-analytics.com
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: image/png,image/*;q=0.8,*/*;q=0.5
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>
>HTTP/1.1 200 OK
>Date: Thu, 01 Mar 2012 23:42:00 GMT
>Content-Length: 35
>X-Content-Type-Options: nosniff
>Pragma: no-cache
>Expires: Wed, 19 Apr 2000 11:43:00 GMT
>Last-Modified: Wed, 21 Jan 2004 19:51:30 GMT
>Content-Type: image/gif
>Cache-Control: private, no-cache, no-cache=Set-Cookie, proxy-revalidate
>Age: 157844
>Server: GFE/2.0
>----------------------------------------------------------
>http://consurf.tau.ac.il/consurf_logo.bmp
>
>GET /consurf_logo.bmp HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: image/png,image/*;q=0.8,*/*;q=0.5
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.6.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>If-Modified-Since: Mon, 27 Aug 2007 16:38:05 GMT
>If-None-Match: "604eb-53a96-438b0fb199540"
>Cache-Control: max-age=0
>
>HTTP/1.1 304 Not Modified
>Date: Sat, 03 Mar 2012 19:32:45 GMT
>Server: Apache/2.2.8 (EL)
>Connection: close
>Etag: "604eb-53a96-438b0fb199540"
>----------------------------------------------------------
>http://consurf.tau.ac.il/results/1330803099/output.php
>
>GET /results/1330803099/output.php HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.6.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>Cache-Control: max-age=0
>
>HTTP/1.1 200 OK
>Date: Sat, 03 Mar 2012 19:33:15 GMT
>Server: Apache/2.2.8 (EL)
>X-Powered-By: PHP/5.1.6
>Connection: close
>Transfer-Encoding: chunked
>Content-Type: text/html; charset=UTF-8
>----------------------------------------------------------
>http://consurf.tau.ac.il/clmenu.css
>
>GET /clmenu.css HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/css,*/*;q=0.1
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.6.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>
>HTTP/1.1 200 OK
>Date: Sat, 03 Mar 2012 19:33:16 GMT
>Server: Apache/2.2.8 (EL)
>Last-Modified: Wed, 26 Aug 2009 14:27:51 GMT
>Etag: "602fb-128-4720c418127c0"
>Accept-Ranges: bytes
>Content-Length: 296
>Connection: close
>Content-Type: text/css
>----------------------------------------------------------
>http://consurf.tau.ac.il/javascript_functions.js
>
>GET /javascript_functions.js HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: */*
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.6.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>If-Modified-Since: Wed, 25 Jan 2012 10:51:11 GMT
>If-None-Match: "68073-4d74-4b7580aada5c0"
>Cache-Control: max-age=0
>
>HTTP/1.1 304 Not Modified
>Date: Sat, 03 Mar 2012 19:33:16 GMT
>Server: Apache/2.2.8 (EL)
>Connection: close
>Etag: "68073-4d74-4b7580aada5c0"
>----------------------------------------------------------
>http://consurf.tau.ac.il/clmenu.js
>
>GET /clmenu.js HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: */*
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.6.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>
>HTTP/1.1 200 OK
>Date: Sat, 03 Mar 2012 19:33:16 GMT
>Server: Apache/2.2.8 (EL)
>Last-Modified: Thu, 13 Aug 2009 12:31:33 GMT
>Etag: "602e0-892-471051da57340"
>Accept-Ranges: bytes
>Content-Length: 2194
>Connection: close
>Content-Type: application/x-javascript
>----------------------------------------------------------
>http://consurf.tau.ac.il/text_8_7.css
>
>GET /text_8_7.css HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: text/css,*/*;q=0.1
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.6.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>If-Modified-Since: Wed, 25 Jan 2012 10:51:13 GMT
>If-None-Match: "680d7-f19-4b7580acc2a40"
>Cache-Control: max-age=0
>
>HTTP/1.1 304 Not Modified
>Date: Sat, 03 Mar 2012 19:33:16 GMT
>Server: Apache/2.2.8 (EL)
>Connection: close
>Etag: "680d7-f19-4b7580acc2a40"
>----------------------------------------------------------
>http://consurf.tau.ac.il/consurf_logo.bmp
>
>GET /consurf_logo.bmp HTTP/1.1
>Host: consurf.tau.ac.il
>User-Agent: Mozilla/5.0 (Macintosh; U; Intel Mac OS X 10.7; en-US;
>rv:1.9.2.27) Gecko/20120216 Firefox/3.6.27
>Accept: image/png,image/*;q=0.8,*/*;q=0.5
>Accept-Language: en-us,en;q=0.5
>Accept-Encoding: gzip,deflate
>Accept-Charset: ISO-8859-1,utf-8;q=0.7,*;q=0.7
>Keep-Alive: 115
>Connection: keep-alive
>Referer: http://consurf.tau.ac.il/results/1330803099/output.php
>Cookie: __utma=128144414.851853261.1330802995.1330802995.1330802995.1;
>__utmb=128144414.6.10.1330802995; __utmc=128144414;
>__utmz=128144414.1330802995.1.1.utmcsr=google|utmccn=(organic)|utmcmd=or
>ganic|utmctr=consurf
>If-Modified-Since: Mon, 27 Aug 2007 16:38:05 GMT
>If-None-Match: "604eb-53a96-438b0fb199540"
>Cache-Control: max-age=0
>
>HTTP/1.1 304 Not Modified
>Date: Sat, 03 Mar 2012 19:33:17 GMT
>Server: Apache/2.2.8 (EL)
>Connection: close
>Etag: "604eb-53a96-438b0fb199540"
>----------------------------------------------------------
>
>
>On Sat, Mar 3, 2012 at 11:01 AM, Shane Neeley <shane.neeley_at_gmail.com>
>wrote:
>
>
> Hi,
>
> Please bare with me, I am new to both cURL and HTML. I have an
>interesting problem and I would like to be able to use cURL to solve it.
>I am trying to access a server located here:
>
> http://consurf.tau.ac.il/index_full_form_PROT.php
>
> I will write a python program that will use cURL to add text to
>the box that says "Paste protein sequence here"
> Then all I need to do is press the submit button at the bottom. I
>am trying to automate this process over thousands of files and I heard
>that cURL might be a great way to do it.
>
> Here would be an example of the FASTA format in quotes that it is
>talking about.
> ">
> DGVGSSSGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISNGTSGGATNDNTYFGYST"
>
> Could somebody please show me how I could fill out that form using
>cURL in my terminal? Thank you sincerely.
>
> Shane.
>

-------------------------------------------------------------------
List admin: http://cool.haxx.se/list/listinfo/curl-users
FAQ: http://curl.haxx.se/docs/faq.html
Etiquette: http://curl.haxx.se/mail/etiquette.html
Received on 2012-03-06